SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022516 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022516
Domain Number 1 Region: 36-156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.64e-16
Family Growth factor receptor domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000022516
Domain Number - Region: 137-189
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00288
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022516   Gene: ENSPTRG00000013154   Transcript: ENSPTRT00000024410
Sequence length 197
Comment pep:novel chromosome:CHIMP2.1.4:20:886590:925015:-1 gene:ENSPTRG00000013154 transcript:ENSPTRT00000024410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLYLLLLVAHADMLALARWGEQVGTGLGGNCTGCIICSEENGCSTCQQRLFLFIHRE
GIRQYGKCLHDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLPT
CPPGTLAHQNTRECQGECELGPWGGWSPCTHNGKTCGSAWGLETRVREAGWAGHEETATC
QVLSESRKCPIQRPCPG
Download sequence
Identical sequences ENSPTRP00000022516 ENSPTRP00000022516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]