SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022552 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022552
Domain Number 1 Region: 198-276,310-524
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.18e-61
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022552   Gene: ENSPTRG00000013173   Transcript: ENSPTRT00000024448
Sequence length 534
Comment pep:known chromosome:CHIMP2.1.4:20:1974611:2020738:1 gene:ENSPTRG00000013173 transcript:ENSPTRT00000024448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHQESPLARAPAGGAAYVKRLCKGLSWREHVESHGSLGAQASPASAAAAEGSATRRARA
TTSRAARSRRQPGPGADHPQAGAPGGKRAARKWRCAGQVTIQGPAPPRPRAGRRDEAGGA
RAAPLLLPLPPAAMETGKDGARRGTQSPERKRRSPVPRAPSTKLRPAAAAQAMDPVAAEA
PGEAFLARRRPEGGGGSARPRYSLLAEIGRGSYGVVYEAVAGRSGARVAVKKIRCDAPEN
VELALAEFWALTSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGER
ILGYAEEPCYLWFVMEFCEGGDLNQYVLSRRPDPATNKSFMLQLTSAIAFLHKNHIVHRD
LKPDNILITERSGTPILKVADFGLSKVCAGLAPRGKEGNQDNKNVNVNKYWLSSACGSDF
YMAPEVWEGHYTAKADIFALGIIIWAMIERITFIDSETKKELLGTYIKQGTEIVPVGEAL
LENPKMELHIPQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQVTCAA
Download sequence
Identical sequences H2QJU0
ENSPTRP00000022552 ENSPTRP00000022552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]