SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022738 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022738
Domain Number 1 Region: 175-215
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000602
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022738   Gene: ENSPTRG00000013256   Transcript: ENSPTRT00000024644
Sequence length 418
Comment pep:known chromosome:CHIMP2.1.4:20:13248442:13278274:1 gene:ENSPTRG00000013256 transcript:ENSPTRT00000024644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNLNVGSDTTSETSFSLSKEAPREHLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLD
LPNFPDLSKADINGQNPNIQVTIEVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSL
SLARANSGDQDYKYDSTSDDSNFLNPPRGWDHTAPGHRTFETKDQPEYDSTDGEGDWSLW
SVCSVTCGNGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNA
TKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKDF
RWKDASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLI
STEFSAELHYKVDVLPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY
Download sequence
Identical sequences 9598.ENSPTRP00000022738 ENSPTRP00000022738 ENSPTRP00000022738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]