SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023095 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023095
Domain Number 1 Region: 282-424
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 178-283
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 98-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023095   Gene: ENSPTRG00000013455   Transcript: ENSPTRT00000025018
Sequence length 881
Comment pep:known chromosome:CHIMP2.1.4:20:32993676:33074755:1 gene:ENSPTRG00000013455 transcript:ENSPTRT00000025018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQS
LDMEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQ
VLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDP
AQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSEL
RFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIML
GVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSA
KRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIK
ELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPS
SPASPSPKGTPEKANERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLA
IERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLVFSRD
LNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTR
VSAMDNTQQVDGSASVGREFIATTPSITTETISTTMENSLKSGKGAAAMIPGPQTVATEI
RSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQ
ALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES
Download sequence
Identical sequences A0A2I2Y9A8 H2QKA1
XP_003831922.1.60992 XP_016793322.1.37143 XP_018872678.1.27298 ENSPTRP00000023095 ENSPTRP00000023095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]