SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023256 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023256
Domain Number 1 Region: 342-568
Classification Level Classification E-value
Superfamily vWA-like 4.9e-61
Family Integrin A (or I) domain 0.00036
Further Details:      
 
Domain Number 2 Region: 12-215
Classification Level Classification E-value
Superfamily vWA-like 1.2e-54
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 3 Region: 217-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000361
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 578-618
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000863
Family Chicken cartilage matrix protein 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023256   Gene: ENSPTRG00000013541   Transcript: ENSPTRT00000025201
Sequence length 622
Comment pep:novel chromosome:CHIMP2.1.4:20:42271673:42289497:-1 gene:ENSPTRG00000013541 transcript:ENSPTRT00000025201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLCWLMLLLLLQPWETQLQLTGPRCHTGPLDLVFVIDSSRSVRPFEFETMRQFLMGL
LPGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYA
MNVAFSVAEGARPPEERVPRVAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADVGS
LRAMASPPLDEHVFLVESFDLIQEFGLQFQSRLCGKDQCAEGGHGCQHQCVNAWAMFHCT
CNPGYKLAADNKSCLAIDLCAEGTHGCEHHCVNSPGSYFCRCQVGFVLQQDQRSCRAIDY
CSFGNHSCQHECVSTPGGPRCHCREGHDLQPDGRSCQVRDLCNGVDHGCEFQCVSEGLSY
RCLCPEGRQLQADGKSCNRCREGHVDLVLLVDGSKSVRPQNFELVKRFVNQIVDFLDVSP
EGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA
QGARPRALNVPRVGLVFTDGRSQDDISVWAARAKEEGIVVYAVGVGKAVEAELREIASEP
AELHVSYAPDFGTMTHLLENLRGSICPEEGISAGTELRSPCECESLVEFQGRTLGALESL
TLNLAQLTARLEDLENQLANQK
Download sequence
Identical sequences H2QKF2
ENSPTRP00000023256 ENSPTRP00000023256 9598.ENSPTRP00000023256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]