SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023839 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023839
Domain Number 1 Region: 65-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-85
Family Protein kinases, catalytic subunit 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023839   Gene: ENSPTRG00000013849   Transcript: ENSPTRT00000025828
Sequence length 714
Comment pep:known chromosome:CHIMP2.1.4:21:17982499:18112350:1 gene:ENSPTRG00000013849 transcript:ENSPTRT00000025828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAAAGDGLLGEPAAPGGGGGAEDAARPAAACEGSFLPAWVSGVPRERLRDFQHHKRVGN
YLIGSRKLGEGSFAKVREGLHVLTGEKVAIKVIDKKRAKKDTYVTKNLRREGQIQQMIRH
PNITQLLDILETENSYYLVMELCPGGNLMHKIYEKKRLEESEARRYIRQLISAVEHLHRA
GVVHRDLKIENLLLDEDNNIKLIDFGLSNCAGILGYSDPFSTQCGSPAYAAPELLARKKY
GPKIDVWSIGVNMYAMLTGTLPFTVEPFSLRALYQKMVDKEMNPLPTQLSTGAISFLRSL
LEPDPVKRPNIQQALANRWLNENYTGKVPCNVTYPNRISLEDLSPSVVLHMTEKLGYKNS
DVINTVLSNRACHILAIYFLLNKKLERYLSGKSDIQDSLCYKTRLYQIEKYRAPKESYEA
SLDTWTRDLEFHAVQDKKPKEQEKRGDFLHRPFSKKLDKNLPSHKQPSGSLMTQIQNTKA
LLKDRKASKSSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQP
GPGSTGIPHKEDPLMLDMVRSFESVDRDDHIEVLSPSHHYRILNSPVSLARRNSSERTLS
PGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCSPPPVPSNGPMQPLGSPNCVKSR
GRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
Download sequence
Identical sequences A0A2J8MPZ7 Q68UT7
ENSPTRP00000023839 ENSPTRP00000023839 9598.ENSPTRP00000023839 NP_001065290.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]