SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024019 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024019
Domain Number 1 Region: 56-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-96
Family Protein kinases, catalytic subunit 0.0000113
Further Details:      
 
Domain Number 2 Region: 639-752
Classification Level Classification E-value
Superfamily KA1-like 7.52e-33
Family Kinase associated domain 1, KA1 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000024019
Domain Number - Region: 321-372
Classification Level Classification E-value
Superfamily UBA-like 0.00175
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024019   Gene: ENSPTRG00000011145   Transcript: ENSPTRT00000026036
Sequence length 752
Comment pep:known chromosome:CHIMP2.1.4:19:50436880:50507351:1 gene:ENSPTRG00000011145 transcript:ENSPTRT00000026036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYR
LLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVK
LFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR
DLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIW
SLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCT
LEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEV
TATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSAAGSGSRGLPPSSPMVSSAH
NPNKAEIPERRKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVP
PASPSSHSLAPPSGERSRLARGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHE
AAPLPAGRPRPTTNLFTKLTSKLTRRVADEPERIGGPEVTSCHLPWDQTETAPRLLRFPW
SVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLP
RPGLRGVLFRRVAGTALAFRTLVTRISNDLEL
Download sequence
Identical sequences H2QL36
ENSPTRP00000024019 XP_003817581.1.60992 XP_512745.3.37143 ENSPTRP00000024019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]