SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024555 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024555
Domain Number 1 Region: 635-744
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.64e-31
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000024555
Domain Number - Region: 745-779
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00853
Family Calponin-homology domain, CH-domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024555   Gene: ENSPTRG00000014259   Transcript: ENSPTRT00000026639
Sequence length 790
Comment pep:known chromosome:CHIMP2.1.4:22:29778960:29794203:1 gene:ENSPTRG00000014259 transcript:ENSPTRT00000026639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPVGPLQVPEREEQEQQAEVSKPTPTPEGINQDVTTVTLLLRAPPGSTSSSPASPSSSPT
PASPEPPLEPAEAQCLTAEVPGSPEPPPSPPKTTSPEPQESSTLPSTEGQVVNKLLSGPK
ETPAAQSTTRGPSDTKRADVAGPRPCQRSLSVLSPRQPAQNRESTPLASGPSSFQRAGSV
RDRVHKFTSDSPMAARLQDGTPRAALSPLTPARLLGPSLTSTTPASSSSGSSSRGPSDTS
SRFSKEQQGVAQPLAQLRSCPQEEGPRGRGLAARPLENRAGGPVARSEEPGALLPVAVGT
AEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKSTIT
RVNSPGTLARLGSVTHVTSFSHAPPSSRGGCSIKMEPEPAEPLAAAVEAANGAEQTQVNK
APEGRCPLSAEELMTIEDEGVLDKMLDQSTDFEERKLIRAALRELRQRKRDQRDKERERR
LQEARGRPGEGRGNTATETTTRHSQRAADGSAVSTVTKTERLVHSNDGTRTARTTTVESS
FVRRSENGSGSTMMQTKTFSSSSSSKKMGSIFDREDQASPRAGSLAALEKRQAEKKKELM
KAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPRAAVQRSTSFGVPNANSIKQMLLDWCR
AKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETH
ADCPQLLDTEDMVRLREPDWKMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRR
HELRLRGKNV
Download sequence
Identical sequences ENSPTRP00000024555 ENSPTRP00000024555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]