SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024957 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024957
Domain Number 1 Region: 19-163,208-316
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-35
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024957   Gene: ENSPTRG00000014484   Transcript: ENSPTRT00000027071
Sequence length 331
Comment pep:known chromosome:CHIMP2.1.4:22:42949765:42976622:1 gene:ENSPTRG00000014484 transcript:ENSPTRT00000027071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE
EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLPLPTNVQVEVITIESTKSGLKSEKLV
EQLTEYSTDKDQPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK
DAKSTLRVLYGLFCKHTQKAHRDRTPRGAPN
Download sequence
Identical sequences H2QLV4
ENSPTRP00000024957 ENSPTRP00000024957 9598.ENSPTRP00000024957 XP_008963056.1.60992 XP_009436845.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]