SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024985 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024985
Domain Number 1 Region: 58-181
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000518
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 133-270
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 258-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000381
Family EGF-type module 0.039
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000024985
Domain Number - Region: 2-32
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00962
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024985   Gene: ENSPTRG00000014498   Transcript: ENSPTRT00000027100
Sequence length 437
Comment pep:known chromosome:CHIMP2.1.4:22:44329431:44400050:1 gene:ENSPTRG00000014498 transcript:ENSPTRT00000027100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGSHSCRLGESCINTVGSFRCQRDSSCGTGLTTWSLSFPAVDINECLSISAPCPIGHTCI
NTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKT
GYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDINECS
SSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQ
CSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPENYRRSAAT
LQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTVISLPTFREFTRPEEIIFLRAITPPHP
ASQANIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMNYVVGGVV
SHRNVVNVHIFVSEYWF
Download sequence
Identical sequences ENSPTRP00000024985 ENSPTRP00000024985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]