SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025082 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025082
Domain Number 1 Region: 47-388
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.53e-98
Family Choline kinase 0.00000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025082   Gene: ENSPTRG00000029391   Transcript: ENSPTRT00000027205
Sequence length 395
Comment pep:known chromosome:CHIMP2.1.4:22:49513508:49517553:-1 gene:ENSPTRG00000029391 transcript:ENSPTRT00000027205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGTAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGA
WRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH
NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP
TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ
ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
Download sequence
Identical sequences H2QLY3
ENSPTRP00000025082 9598.ENSPTRP00000025082 XP_001144556.1.37143 XP_003804638.1.60992 ENSPTRP00000025082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]