SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025092 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025092
Domain Number 1 Region: 296-372
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 406-502
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-17
Family PDZ domain 0.0000203
Further Details:      
 
Domain Number 3 Region: 1489-1554
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.14e-16
Family SAM (sterile alpha motif) domain 0.000064
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000025092
Domain Number - Region: 98-196
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000514
Family Ankyrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025092   Gene: ENSPTRG00000014553   Transcript: ENSPTRT00000027217
Sequence length 1557
Comment pep:novel chromosome:CHIMP2.1.4:22:49606225:49664154:1 gene:ENSPTRG00000014553 transcript:ENSPTRT00000027217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGPGASAVVVRVGIPDLQQTKCLRLDPAAPVWAAKQRVLCALNHSLQDALNYGLFQPPS
RGRAGKFLDEERLLQEYPPNLDTPLPYLEFRYKRRVYAQNLIDDKQFAKLHTKANLKKFM
DYVQLHSTDKVARLLDKGLDPNFHDPDSGECPLSLAAQLDNATDLLKVLKNGLRDLDFRS
RDGVSLKRGATRQRNAAALTPFRETPSYAKRRRLAGPSGLASPRPLQRSASDINLKGEAQ
PAASPGPSLRSLPHQLLLQRLQEEKDRDRDADQESNISGPLAGRASQSKIVHRAHPQPPP
RGPKRKLYSAVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWF
PKDCVEEVQMRQQPPRVETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAVLQKRDHE
GFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVK
VGHKQVVALIRQGGNRLVMKVVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAEL
EELGEWRGREGSKKLDEMLAAAAEPTLRPDIADADSRAATVKQRPTSRRITPAEISSLFE
RQGLPGPEKLPGSLRKGIPRTKSVGEDEKLASLLEGRFPRSTSMLDPVREGRGIPPPPQN
PGRAYDTVRSSFKPGLEARLGAGAAGLYEPGAALGPLPYPERQKRARSMIILQDSAPESG
DAPRPPPAATPPERPKRRPRPPGPDSPYANLGAFSASLFAPSKPQRRKSPLVKQLQVEDA
QERAALAVGSPGPGGGSFAREPSPTHRGPRPGGLEYGAGDGPGLAFGGPGPAKDRRLEER
RRSTVFLSVGAIEGSAPSADLPSLQPSRSIDERLLGTGPTAGRDLLLPSPVSALKPLVSG
PSLGPSGSTFIHPLTGKPLDPSSPLALALAARERALASQAPSRSPTPVHSPDADRPGPLF
VDVQARDPERGSLASPAFSPRSPAWIPVPARREAEKVPREERKSPEDKKSMILSVLDTSL
QRPAGLIVVHATSNGQEPSRLGGAEEERPGTPELAPAPMQSAAVAEPLPSPRAQPPGGTP
ADAGPGQGSSEEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANGVLLATPL
AGPGPSPTTVPSPASGKPSSEPPPAPESAADSGVEEADTRSSSDPHLETTSTISTVSSMS
TLSSESGELTDTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSSDSELM
AQQHHAASAGLASAAGPARPRYLFQRRSKLWGDPVESRGLPGPEDDKPTVISELSSRLQQ
LNKDTRSLGEEPVGGLGSLLDPAKKSPIAAARCRSPMVGLRLFSSLGELSSISAQRSPGG
PGGGASYSVRPSGRYPVARRAPSPVKPASLERVEGLGAGAGGAGRPFGLTPPTILKSSSL
SIPHEPKEVRFVVRSVSARSRSPSPSPLPSPASGPGPGAPGPRRPFQQKPLQLWSKFDVG
DWLESIHLGEHRDRFEDHEIEGAHLPALTKDDFVELGVTRVGHRMNIERALRQLDGS
Download sequence
Identical sequences ENSPTRP00000025092 ENSPTRP00000025092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]