SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025197 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025197
Domain Number 1 Region: 194-345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000124
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025197   Gene: ENSPTRG00000014604   Transcript: ENSPTRT00000027326
Sequence length 412
Comment pep:novel chromosome:CHIMP2.1.4:3:10140584:10151246:1 gene:ENSPTRG00000014604 transcript:ENSPTRT00000027326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWPPKGLVPAVLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNKGL
ERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWW
FHKQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGTRGGSGH
CDCQAGYRGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQCKKGWALHH
LKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVG
SKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPGAFPILLTPET
TRRWKLGSHPHSTYVKTKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRLIH
Download sequence
Identical sequences ENSPTRP00000025197 ENSPTRP00000025197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]