SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025243 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025243
Domain Number 1 Region: 30-211
Classification Level Classification E-value
Superfamily TIMP-like 5.1e-68
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025243   Gene: ENSPTRG00000014630   Transcript: ENSPTRT00000027374
Sequence length 224
Comment pep:known chromosome:CHIMP2.1.4:3:12366621:12372829:-1 gene:ENSPTRG00000014630 transcript:ENSPTRT00000027374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSPRPAPSWVLLLRLLALLWPLGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPA
SADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQV
LSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTD
WLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Download sequence
Identical sequences H2QM27
XP_516284.1.37143 9598.ENSPTRP00000025243 ENSPTRP00000025243 ENSPTRP00000025243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]