SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025252 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025252
Domain Number 1 Region: 364-631
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-73
Family Protein kinases, catalytic subunit 0.00000000171
Further Details:      
 
Domain Number 2 Region: 56-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-26
Family Ras-binding domain, RBD 0.0000114
Further Details:      
 
Domain Number 3 Region: 130-184
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000598
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025252   Gene: ENSPTRG00000014635   Transcript: ENSPTRT00000027387
Sequence length 668
Comment pep:known chromosome:CHIMP2.1.4:3:12799469:12881950:-1 gene:ENSPTRG00000014635 transcript:ENSPTRT00000027387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIENNNLSASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVNPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
Download sequence
Identical sequences A0A2I3THL4
ENSPTRP00000025252 ENSPTRP00000025252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]