SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025362 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025362
Domain Number 1 Region: 511-697
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-48
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 138-349,388-472
Classification Level Classification E-value
Superfamily ARM repeat 3.2e-23
Family Armadillo repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025362   Gene: ENSPTRG00000014703   Transcript: ENSPTRT00000027503
Sequence length 713
Comment pep:known chromosome:CHIMP2.1.4:3:27632779:27788829:-1 gene:ENSPTRG00000014703 transcript:ENSPTRT00000027503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQDKKVKTTEKSTDKKQQEITIRDYSDLKRLRCLLNVQSSKQQLPAINFDSAQNSMTK
SEPAIRAGGHRARGQWHESTEAVELENFSINYKNERNFSKHPQRKLFQEIFTALVKNRLI
CREWVNRAPSIHFLRVLICLRLLMRDPCYQEILHSLGGIENLAQYMEIVANEYLGYGEEQ
HTVDKLVNMTYIFQKLAAVKDQREWVTTSGAHKTLVNLLGARDTNVLLGSLLALASLAES
QECREKISELNIVENLLMILHEYDLLSKRLTAELLRLLCAEPQVKEQVKLYEGIPVLLSL
LHSDHLKLLWSIVWILVQVCEDPETSVEIRIWGGIKQLLHILRGDRNFVSDHSSIGSLSS
ANAAGRIQQLHLSEDLSPREIQENTFSLQAACCAALTELVLNDTNAHQVVQENGVYTIAK
FILPNKQKNAAKSNLLQCYAFRALRFLFSMERNRPLFKRLFPTDLFEIFIDIGHYVRDIS
AYEELVSKLNLLVEDELKQIAENIESINQNKAPSKYIGNYAILDHLGSGAFGCVYKVRKR
SGQNLLAMKEVNLHNPAFGKDKKDRDSSVKNIVSELTIIKEQLYHPNIVRYYKTFLENDR
LYIVMELIEGAPLGEHFSSLKEKHQHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPN
NIMLGDKDKVTVTDFGLAKQKQENSKLTSVVGTILYSCVQHLSLRSPAPALAT
Download sequence
Identical sequences H2QM77
ENSPTRP00000025362 ENSPTRP00000025362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]