SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025450 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025450
Domain Number 1 Region: 8-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-84
Family Protein kinases, catalytic subunit 0.00000457
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000025450
Domain Number - Region: 466-523
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 0.0314
Family GyrA/ParC C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025450   Gene: ENSPTRG00000014755   Transcript: ENSPTRT00000027597
Sequence length 527
Comment pep:known chromosome:CHIMP2.1.4:3:38748581:38838602:1 gene:ENSPTRG00000014755 transcript:ENSPTRT00000027597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDEL
LKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDE
STIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRN
KVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTL
QNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFL
QEKILQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGKAAISQLRSP
RVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIPTQPTQVSLPPTAEPAKTAQA
LSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLV
IVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS
Download sequence
Identical sequences G3QU09 H2QMA9
ENSGGOP00000006197 9598.ENSPTRP00000025450 ENSPTRP00000025450 ENSGGOP00000006197 ENSPTRP00000025450 XP_004033907.2.27298 XP_526174.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]