SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025456 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025456
Domain Number 1 Region: 179-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-59
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 25-118
Classification Level Classification E-value
Superfamily Snake toxin-like 1.69e-35
Family Extracellular domain of cell surface receptors 0.00000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025456   Gene: ENSPTRG00000014760   Transcript: ENSPTRT00000027603
Sequence length 512
Comment pep:known chromosome:CHIMP2.1.4:3:39038695:39068343:1 gene:ENSPTRG00000014760 transcript:ENSPTRT00000027603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
Download sequence
Identical sequences A0A2I3SJM1 Q13705
ENSPTRP00000025456 gi|116734708|ref|NP_001097.2| 9598.ENSPTRP00000025456 9606.ENSP00000340361 ENSPTRP00000025456 ENSP00000340361 NP_001097.2.87134 NP_001097.2.92137 XP_516369.2.37143 ENSP00000340361 ENSP00000340361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]