SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025788 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025788
Domain Number 1 Region: 43-522
Classification Level Classification E-value
Superfamily Sema domain 3.27e-115
Family Sema domain 0.00000257
Further Details:      
 
Domain Number 2 Region: 1085-1344
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-74
Family Protein kinases, catalytic subunit 0.0000000202
Further Details:      
 
Domain Number 3 Region: 681-769
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000165
Family Other IPT/TIG domains 0.064
Further Details:      
 
Domain Number 4 Region: 522-569
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000188
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 767-861
Classification Level Classification E-value
Superfamily E set domains 0.0000000137
Family Other IPT/TIG domains 0.042
Further Details:      
 
Domain Number 6 Region: 566-621
Classification Level Classification E-value
Superfamily E set domains 0.000000168
Family Other IPT/TIG domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025788   Gene: ENSPTRG00000014941   Transcript: ENSPTRT00000027958
Sequence length 1400
Comment pep:known chromosome:CHIMP2.1.4:3:50673789:50692486:-1 gene:ENSPTRG00000014941 transcript:ENSPTRT00000027958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIRGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCSQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLERVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG
ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LALPAIDGLDSTTCVHGASFSDSEDESCVPLLWKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH
LNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM
QQCWEADPAVRPTFGVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF
SPMPGNVRRPRPLSEPPQPT
Download sequence
Identical sequences H2QMM8
9598.ENSPTRP00000025788 ENSPTRP00000025788 XP_009443790.1.37143 ENSPTRP00000025788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]