SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025842 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025842
Domain Number 1 Region: 36-343
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-82
Family Protein kinases, catalytic subunit 0.000000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025842   Gene: ENSPTRG00000014968   Transcript: ENSPTRT00000028016
Sequence length 382
Comment pep:known chromosome:CHIMP2.1.4:3:51415426:51447286:1 gene:ENSPTRG00000014968 transcript:ENSPTRT00000028016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLE
CFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVRILDVYENMHHGKRCLLIIMEC
MEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKD
AVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYIILCGFP
PFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLLKTDPTERLTITQFMN
HPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNR
LLNKRRKKQAGSSSASQGCNNQ
Download sequence
Identical sequences H2QMP5
XP_016796662.1.37143 XP_016796663.1.37143 9598.ENSPTRP00000025842 ENSPTRP00000025842 ENSPTRP00000025842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]