SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025882 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025882
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.73e-38
Family Cofilin-like 0.00000268
Further Details:      
 
Domain Number 2 Region: 167-325
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.84e-37
Family Cofilin-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025882   Gene: ENSPTRG00000042003   Transcript: ENSPTRT00000028057
Sequence length 349
Comment pep:known chromosome:CHIMP2.1.4:3:53072481:53083046:-1 gene:ENSPTRG00000042003 transcript:ENSPTRT00000028057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQELVGRWDQDYDRAVLPL
LDAQQPCYLLYRLDSQNAQGFEWLFLAWSPDNSPVRLKMLYAATRATVKKEFGGGHIKDE
LFGTVKDDLSFAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAF
PLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVPRDAARYHFFL
YKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLLDSVEQDFHLEIAKKIEIGDG
AELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENGDDS
Download sequence
Identical sequences H2QMR1
ENSPTRP00000025882 ENSPTRP00000025882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]