SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025952 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025952
Domain Number 1 Region: 156-480
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-92
Family Protein kinases, catalytic subunit 0.000000000455
Further Details:      
 
Domain Number 2 Region: 3-95
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-23
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025952   Gene: ENSPTRG00000015023   Transcript: ENSPTRT00000028129
Sequence length 487
Comment pep:known chromosome:CHIMP2.1.4:3:54044551:54054106:1 gene:ENSPTRG00000015023 transcript:ENSPTRT00000028129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QECNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGS
LLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASTEP
VGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELK
GRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEF
LNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKI
ADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFH
GDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWT
LLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPK
FEHLLED
Download sequence
Identical sequences ENSPTRP00000025952 ENSPTRP00000025952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]