SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026116 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026116
Domain Number 1 Region: 266-455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-35
Family Laminin G-like module 0.00000416
Further Details:      
 
Domain Number 2 Region: 469-669
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-27
Family Laminin G-like module 0.0000384
Further Details:      
 
Domain Number 3 Region: 41-93
Classification Level Classification E-value
Superfamily GLA-domain 2.52e-20
Family GLA-domain 0.00039
Further Details:      
 
Domain Number 4 Region: 120-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000026116
Domain Number - Region: 241-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000402
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026116   Gene: ENSPTRG00000015128   Transcript: ENSPTRT00000028301
Sequence length 676
Comment pep:known chromosome:CHIMP2.1.4:3:96874911:96977521:-1 gene:ENSPTRG00000015128 transcript:ENSPTRT00000028301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQILVRKRRANSLLEETKQGNLERECIE
ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQ
CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG
SYHCSCKSGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS
CEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLNTKYELL
YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIE
VQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE
KGSYYPGSGIAQFHIDYNNVSGAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLV
DSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL
QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHND
IRAHSCPSVWKKTKNS
Download sequence
Identical sequences H2QMY8
ENSPTRP00000026116 ENSPTRP00000026116 XP_516603.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]