SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026129 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026129
Domain Number 1 Region: 349-423,466-679
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-80
Family Protein kinases, catalytic subunit 0.00000000248
Further Details:      
 
Domain Number 2 Region: 56-260
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-34
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 3 Region: 684-756
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-20
Family SAM (sterile alpha motif) domain 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000026129
Domain Number - Region: 3-48,94-109
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00196
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026129   Gene: ENSPTRG00000015134   Transcript: ENSPTRT00000028314
Sequence length 761
Comment pep:novel chromosome:CHIMP2.1.4:3:99880733:100843413:1 gene:ENSPTRG00000015134 transcript:ENSPTRT00000028314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAP
RNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGL
INNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWAS
QNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHI
RVRTATGYSGYSQKFEFETGDETSDMAAEQGQILVIATAAVGGFTLLVILTLFFLITGRC
QWYIKAKMKSEEKRRNHLQNGHLRFPGIKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIER
VIGAGEFGEVCSGRLKTPGKREIPVAIKTLKGGHMDRQRRDFLREASIMGQFDHPNIIRL
EGVVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPHPVPGGGSLPPRIPAGRPVMIVVEYME
NGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILVNSNLVCKVS
DFGLSRVLEDDPEAAYTTTGGKIPIRWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGER
PYWEMSNQDVILSIEEGYRLPAPMGCPASLHQLMLHCWQKERNHRPKFTDIVSFLDKLIR
NPSALHTLVEDILVMPESPGEVPEYPLFVTVGDWLDSIKMGQYKNNFVAAGFTTFDLISR
MSIDDIRRIGVILIGHQRRIVSSIQTLRLHMMHIQEKGFHV
Download sequence
Identical sequences ENSPTRP00000026129 ENSPTRP00000026129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]