SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026315 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026315
Domain Number 1 Region: 55-386
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-84
Family Protein kinases, catalytic subunit 0.0000000000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026315   Gene: ENSPTRG00000015264   Transcript: ENSPTRT00000028514
Sequence length 429
Comment pep:known chromosome:CHIMP2.1.4:3:123195237:123464921:-1 gene:ENSPTRG00000015264 transcript:ENSPTRT00000028514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAQTLPVILYMYQLFRSLAYIHSFGICHRDIKP
QNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAG
CVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKD
SSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLP
NGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNA
ASASASNST
Download sequence
Identical sequences 9598.ENSPTRP00000026315 ENSPTRP00000026315 ENSPTRP00000026315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]