SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026378 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026378
Domain Number 1 Region: 111-557
Classification Level Classification E-value
Superfamily Sema domain 3.4e-135
Family Sema domain 0.00000012
Further Details:      
 
Domain Number 2 Region: 848-905
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000034
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 662-712
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000968
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 905-962
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000196
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 5 Region: 553-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000767
Family Plexin repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 716-768
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 
Domain Number 7 Region: 963-1007
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000106
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000026378
Domain Number - Region: 607-659
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000144
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026378   Gene: ENSPTRG00000015301   Transcript: ENSPTRT00000028578
Sequence length 1149
Comment pep:known chromosome:CHIMP2.1.4:3:126290169:126344045:-1 gene:ENSPTRG00000015301 transcript:ENSPTRT00000028578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCGFTPSPVAHHLVPGRPDTPAQQLRCGWTVGGWLLSLVRGFLPCLPPGARTAEGPIMV
LAGPLAVSLLLPSLTLLVSHLSSSQDVSSEPSSEQQLCALSEHPTVAFEDLQPWVSNFTY
PGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEE
ECQNYVRVLIVAGRKVFMCGTNAFSPMCTSRQVGSSGWRRLKGAPXXXXXXXHNSTAVIS
SQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLR
ENAVEHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSA
FHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPN
FQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAK
DTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARALFV
GLSDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACP
VRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCS
RNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVP
IFWASWGSWSKCSSNCGGGVQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPW
LPVNVTQGGARQEQRFRFTCRAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEDLL
RSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDC
NPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQ
ACPEGWSPWSEWSKCTDDGAQSRSRHCEELLPGPSACAGNSSQSRPCPYSEIPVILPASS
MEEATGCAGFNLIHLVATGISCFLGSGLLTLAVYLSCQHCQRQSQESTLVHPATPNHLHY
KGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPEAS
PGQRCFPNS
Download sequence
Identical sequences ENSPTRP00000026378 ENSPTRP00000026378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]