SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026543 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026543
Domain Number 1 Region: 412-631
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.44e-55
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0039
Further Details:      
 
Domain Number 2 Region: 25-353
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.67e-49
Family Protein kinases, catalytic subunit 0.062
Further Details:      
 
Domain Number 3 Region: 616-771
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.42e-40
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026543   Gene: ENSPTRG00000015402   Transcript: ENSPTRT00000028763
Sequence length 780
Comment pep:known chromosome:CHIMP2.1.4:3:136058185:136161437:-1 gene:ENSPTRG00000015402 transcript:ENSPTRT00000028763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPGATGESDLAEVLPQHKFDSKSLEAYLNQHLSGFGAEREATLSIAQYRAGKSNPTFYL
QKGFQTYVLRKKPPGSLLPKAHQIDREFKVQKALFSIGFPVPKPILYCSDTSVIGTEFYV
MEHVQGRIFRDLTIPGLSPAERSAIYVATVETLAQLHSLNIQSLQLEGYGIGAGYCKRQV
STWTKQYQAAAHQDIPAMQQLSEWLMKNLPDNDNEENLIHGDFRLDNIVFHPKECRVIAV
LDWELSTIGHPLSDLAHFSLFYFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINS
ILPNWNFFLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPLAETGLQLSKRTFS
TVLPQIDTTGQLFVQTRKGQEVLIKVKHFMKQHILPAEKEVTEFYVQNENSADKWGKPLV
IDKLKEMAKVEGLWNLFLPAVSGLSHVDYALIAEETGKCFFAPDVFNCQAPDTGNVEVLH
LYGSEEQKKQWLEPLLQGNITSCFCMTEPDVASSDATNIECSIQRDEDSYVINGKKWWSS
GAGNPKCKIAIVLGRTQNTSLSRHKQHSMILVPMNTPGVEIIRPLSVFGYTDNFHGGHFE
IHFNQVRVPATNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERALQIMCERATQRTAF
KKKLYAHEVVAHWIAESRIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSK
IVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI
Download sequence
Identical sequences K6ZKS6
ENSPTRP00000026543 ENSPTRP00000026543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]