SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026572 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026572
Domain Number 1 Region: 160-449
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.79e-63
Family Protein kinases, catalytic subunit 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026572   Gene: ENSPTRG00000015419   Transcript: ENSPTRT00000028792
Sequence length 460
Comment pep:known chromosome:CHIMP2.1.4:3:137665419:137717657:-1 gene:ENSPTRG00000015419 transcript:ENSPTRT00000028792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNT
SRTIYDPVHAAPTTSTRVFYISVGVCCAVIFLVAIILAVLHLHSMKRIELDDSISASSSS
QGLSQPSTQTTQYLRADTPNNATPITSSLGYPTLRIEKNDLRSVTLLEAKAKVKDIAISR
ERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRG
LHHRNLLPITHVCIEEGEKPMVILPYMNWGNLKLFLRQCKLVEANNPQAISQQDLVHMAI
QIACGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRDLFPMDYHCLGDNENRPVR
WMALESLVNNEFSSASDVWAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINC
PDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALGAYV
Download sequence
Identical sequences ENSPTRP00000026572 ENSPTRP00000026572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]