SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026645 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026645
Domain Number 1 Region: 191-515
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-78
Family Protein kinases, catalytic subunit 0.00000189
Further Details:      
 
Domain Number 2 Region: 34-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.02e-29
Family Regulator of G-protein signaling, RGS 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026645   Gene: ENSPTRG00000015475   Transcript: ENSPTRT00000028873
Sequence length 553
Comment pep:known chromosome:CHIMP2.1.4:3:145329752:145369066:1 gene:ENSPTRG00000015475 transcript:ENSPTRT00000028873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLC
EQQPIGHRLFRDFLATVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVATCASAPAPG
NPQPFLRQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKL
FEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKGGEKMALLEK
EILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSAQI
ACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVEMKGGKPITQRAGTNGYMAPE
ILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFT
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYA
KDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCG
EGNSSKSGVCLLL
Download sequence
Identical sequences A0A2I3RN80
ENSPTRP00000026645 XP_526333.2.37143 ENSPTRP00000026645 9598.ENSPTRP00000026645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]