SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026654 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026654
Domain Number 1 Region: 1437-1516
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000109
Family Double-stranded RNA-binding domain (dsRBD) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026654   Gene: ENSPTRG00000015482   Transcript: ENSPTRT00000028884
Sequence length 1705
Comment pep:known chromosome:CHIMP2.1.4:3:145876847:146024307:-1 gene:ENSPTRG00000015482 transcript:ENSPTRT00000028884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHHCSHPNDDDVHFRISDDKI
FTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAVEKGE
TLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHK
IMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCA
PEETTFHLLHLSLMREYIDYEFSVLKEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHL
HINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKW
FESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWAALDKNEGEMITSKDNLEDET
EDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWY
YPYHYAPFLSDIHNISTLKIHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSP
IIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLM
YWYDRDTEFIYPSPWPEKFPAIERCCTRYKIISLDAWRVDINKNKITRIDQKALYFCGFP
TLKHIKHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDELTVENVASSVLGKSVFVNWP
HLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEH
YLRRKGIIINETSAVVYAQLLTGRKYQINQNGEVRLEKQWSKQVVPFVYQTMVKDIRAFD
SRFSNIKTLDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVIFSIPCEPNLDAL
IQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIGRGSRRNPHGDHKANVGLNLKFN
KKNEEVPGYTKKVGSEWMYSSAAEQLLAEYLERAPELFSYIAKNSQEDVFYEDDIWPGEN
ENGAEKVQEIITWLKGHPVSTLSRSSCDLQILDAAIVEKIEEEVEKCKQRKNNKKVRVTV
KPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLF
EVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSRSETGNQKLTAIVKPQPAVHQHSS
SSSVSSGHLGGLNHSPQSLFVPTQVPTKDDDEFCNIWQSLQGSGKMQHFQPTVQEKGAVL
PQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKMSNKQPNSGIEN
FLASLNISKENEVQSSHHGEPPSEEHLSPQSFAMGTRMLKEILKIDGSNTVDHKNEIKQI
ANEIPISSNRRDEYGLPSQPKQNKKLASYMNKPHSANEYHNVQSMDNMCWPAPSQIPPVS
TPVTELSRICSLVGMPQPDFSFLRTPQTMTVCQVKLSNGLLVHGPQCHSENEAKEKAALF
ALQQLGSLGMNFPLPSPVFANYPSAVPPGTIPPVFPPPTGWDHYGSNYALGAANIMPSSS
HLFGSMPWGPSVPVPGKPFHHTLYSGTMPMAGGIPGGVHNQFIPLQVTKKRVANKKNFEN
KEAQSSQATPVQTSQPDSSNIVKVSPRESSSASLKSSPIAQPASFQVETASQGHSISHHK
STPISSSRRKSRKLAVNFGVSKPSE
Download sequence
Identical sequences 9598.ENSPTRP00000026654 ENSPTRP00000026654 ENSPTRP00000026654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]