SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026979 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026979
Domain Number 1 Region: 406-529
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-36
Family DEP domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-23
Family DIX domain 0.0018
Further Details:      
 
Domain Number 3 Region: 228-338
Classification Level Classification E-value
Superfamily PDZ domain-like 3.33e-23
Family PDZ domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026979   Gene: ENSPTRG00000015681   Transcript: ENSPTRT00000029234
Sequence length 716
Comment pep:known chromosome:CHIMP2.1.4:3:188186557:188202095:1 gene:ENSPTRG00000015681 transcript:ENSPTRT00000029234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
Download sequence
Identical sequences A0A0D9RM79 A0A2K5KDU8 A0A2K5N8A8 A0A2K6KFG4 H2QNU7 Q92997
gi|41406097|ref|NP_004414.3| 9598.ENSPTRP00000026979 9606.ENSP00000316054 ENSPTRP00000026979 NP_004414.3.87134 NP_004414.3.92137 XP_003806635.1.60992 XP_007970124.1.81039 XP_010364499.1.97406 XP_011801240.1.43180 XP_011889885.1.92194 XP_017721442.1.44346 XP_018878593.1.27298 XP_516908.3.37143 ENSPTRP00000026979 ENSP00000316054 ENSGGOP00000007277 ENSP00000316054 ENSGGOP00000007277 ENSP00000316054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]