SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027395 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027395
Domain Number 1 Region: 140-281
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-29
Family Prokaryotic proteases 0.0000221
Further Details:      
 
Domain Number 2 Region: 24-94
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000104
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 3 Region: 80-126
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000127
Family Ovomucoid domain III-like 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000027395
Domain Number - Region: 290-332
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00325
Family HtrA-like serine proteases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027395   Gene: ENSPTRG00000015903   Transcript: ENSPTRT00000029693
Sequence length 333
Comment pep:known chromosome:CHIMP2.1.4:4:8444248:8480379:1 gene:ENSPTRG00000015903 transcript:ENSPTRT00000029693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQARALLLAALAALALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVCAASEGE
PCGGPLDSPCGESLECVRGLCRCRGSHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQ
LQKGACPLGLHQLSSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIM
SEAGLIITNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKYGNS
GGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMRTIT
PSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQ
Download sequence
Identical sequences ENSPTRP00000027395 ENSPTRP00000027395 9598.ENSPTRP00000027395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]