SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027599 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027599
Domain Number 1 Region: 259-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-80
Family Protein kinases, catalytic subunit 0.0000000192
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 1.8e-34
Family SH2 domain 0.0000383
Further Details:      
 
Domain Number 3 Region: 57-139
Classification Level Classification E-value
Superfamily SH3-domain 1.9e-16
Family SH3-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027599   Gene: ENSPTRG00000016040   Transcript: ENSPTRT00000029906
Sequence length 527
Comment pep:known chromosome:CHIMP2.1.4:4:83906141:83973230:1 gene:ENSPTRG00000016040 transcript:ENSPTRT00000029906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILSSYNTIQSVFCCCCCCSVQKRQVRTQISLSTDEELPEKYTQHRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPYLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
Download sequence
Identical sequences A0A2I3T8H3
XP_003816057.1.60992 XP_016807272.1.37143 XP_517311.3.37143 ENSPTRP00000027599 ENSPTRP00000027599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]