SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027639 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027639
Domain Number 1 Region: 815-942,986-1160
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-77
Family Protein kinases, catalytic subunit 0.000000000103
Further Details:      
 
Domain Number 2 Region: 662-754
Classification Level Classification E-value
Superfamily Immunoglobulin 7.41e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 339-452
Classification Level Classification E-value
Superfamily Immunoglobulin 4.3e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 227-330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000033
Family I set domains 0.045
Further Details:      
 
Domain Number 5 Region: 556-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000115
Family V set domains (antibody variable domain-like) 0.041
Further Details:      
 
Domain Number 6 Region: 432-460,493-545
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000318
Family I set domains 0.071
Further Details:      
 
Domain Number 7 Region: 114-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000757
Family I set domains 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000027639
Domain Number - Region: 32-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000136
Family I set domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027639   Gene: ENSPTRG00000016069   Transcript: ENSPTRT00000029949
Sequence length 1356
Comment pep:known chromosome:CHIMP2.1.4:4:74889244:74936609:1 gene:ENSPTRG00000016069 transcript:ENSPTRT00000029949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPVKYLGYPPP
EIKWYKNGIPLESNHTIKVGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECPNEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
Download sequence
Identical sequences 9598.ENSPTRP00000027639 ENSPTRP00000027639 ENSPTRP00000027639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]