SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027670 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027670
Domain Number 1 Region: 157-195,229-266
Classification Level Classification E-value
Superfamily Immunoglobulin 8.8e-17
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000926
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 111-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000134
Family Ovomucoid domain III-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027670   Gene: ENSPTRG00000016090   Transcript: ENSPTRT00000029982
Sequence length 282
Comment pep:known chromosome:CHIMP2.1.4:4:72852544:72933018:1 gene:ENSPTRG00000016090 transcript:ENSPTRT00000029982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCC
PMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVC
GSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLS
CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSK
EDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Download sequence
Identical sequences G3RJG1 H2QPI9 Q16270
NP_001544.1.87134 NP_001544.1.92137 XP_018880788.1.27298 XP_517274.3.37143 ENSPTRP00000027670 ENSPTRP00000027670 ENSP00000295666 NYSGRC-IgSF-IBP7_HUMAN Q16270 9606.ENSP00000295666 gi|4504619|ref|NP_001544.1| ENSP00000295666 ENSP00000295666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]