SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027791 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027791
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.49e-22
Family Protein kinases, catalytic subunit 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027791   Gene: ENSPTRG00000016174   Transcript: ENSPTRT00000030106
Sequence length 313
Comment pep:known chromosome:CHIMP2.1.4:4:54475972:54503025:1 gene:ENSPTRG00000016174 transcript:ENSPTRT00000030106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAVDVWAIGCLVTEMFMGEPLFPGDSDIDQLYHIMMCLGNLIPRHQELFYKNPVFAGVRL
PEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQEL
QLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKDCKLFKIKGSK
IDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNVSVDHTRNPSVAIPPLTHNLS
AVAPSINSGMGTATIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSD
DSGADLPQMEHQH
Download sequence
Identical sequences ENSPTRP00000027791 ENSPTRP00000027791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]