SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027990 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027990
Domain Number 1 Region: 841-925
Classification Level Classification E-value
Superfamily DEATH domain 6.28e-24
Family DEATH domain, DD 0.0000456
Further Details:      
 
Domain Number 2 Region: 168-260
Classification Level Classification E-value
Superfamily Immunoglobulin 3.21e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 259-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 4 Region: 313-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 5 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000175
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027990   Gene: ENSPTRG00000016296   Transcript: ENSPTRT00000030323
Sequence length 931
Comment pep:known chromosome:CHIMP2.1.4:4:97545062:97933439:-1 gene:ENSPTRG00000016296 transcript:ENSPTRT00000030323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKSTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLG
GHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGAL
LTRPVVLTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHIL
TENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQ
MGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCT
FTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQN
FPDGNLSMLAAVLEEMGRHETVVSLAAEGQY
Download sequence
Identical sequences ENSPTRP00000027990 ENSPTRP00000027990 9598.ENSPTRP00000027990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]