SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028078 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028078
Domain Number 1 Region: 156-255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000455
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 44-180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000863
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028078   Gene: ENSPTRG00000016343   Transcript: ENSPTRT00000030412
Sequence length 388
Comment pep:known chromosome:CHIMP2.1.4:4:108474543:108522588:1 gene:ENSPTRG00000016343 transcript:ENSPTRT00000030412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYM
LMPDGSCSSALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASC
PRFRQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNIRGSYKC
KCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDRGHNNWIPDVGSTWWPPKTP
YIPPIITNRPTSKPTTRPTPKPTPIPTPPPPPPPPLPTELRTLLPPTTPERPTTGLTTIA
PAASTPPGGITVDNRVQTDPQKPRGDVF
Download sequence
Identical sequences ENSPTRP00000028078 ENSPTRP00000028078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]