SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028080 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028080
Domain Number 1 Region: 380-548
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-37
Family Ypt/Rab-GAP domain of gyp1p 0.0017
Further Details:      
 
Domain Number 2 Region: 526-638
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 
Domain Number 3 Region: 41-222
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-25
Family Protein kinases, catalytic subunit 0.0021
Further Details:      
 
Domain Number 4 Region: 686-820
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.31e-17
Family Multidomain sulfurtransferase (rhodanese) 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028080   Gene: ENSPTRG00000016344   Transcript: ENSPTRT00000030414
Sequence length 830
Comment pep:known chromosome:CHIMP2.1.4:4:108628745:108903879:-1 gene:ENSPTRG00000016344 transcript:ENSPTRT00000030414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPLKDAEMGAFTFFASALPHDVCGSNGLPLTPNSIKILGRFQILKTITHPRLCQYVDIS
RGKHERLVVVAEHCERSLEDLLRERKPVRYPSYLAPEVIAQGIFKTTDHMPSKKPLPSGP
KSDVWSLGIILFELCVGRKLFQSLDISERLKFLLTLDCVDDTLIVLAEEHGCLDIIKELP
ETVIDLLKKCLTFHPSKRPTPDELMKDKVFSEVSPLYTPFTKPASLFSSSLRCADLTLPE
DISQLCKDINNDYLAERSIEEVYYLWCLAGGDLEKELVNKEIIRSKPPICTLPNFLFEDG
ESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEAFYPLLEDDQSNLPHSNSNNELSAA
ATLPLIIREKDTEYQLNRIILFDRLLKAYPYKKNQIWKEARVDIPPLMRGLTWAALLGVE
GAIHAKYDAIDKDTPIPTDRQIEVDIPRCHQYDELLSSPEGHAKFRRVLKAWVVSHPDLV
YWQGLDSLCAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDNSHVIQEYLTVFSQMIAF
HDPELSNHLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGVAIL
QQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDS
SGVRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHFKTP
TKKTKSSKPKLLVVDIRNSEDFIRGHIAGSINIPFSAAFTAEGELTQGPYTAMLQNFKGK
VIVIVGHVAKHTAEFAAHLVKMKYPRICILDGGINKIKPTGLLTIPSPQI
Download sequence
Identical sequences H2QQ00
ENSPTRP00000028080 ENSPTRP00000028080 XP_001170726.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]