SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028123 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028123
Domain Number 1 Region: 43-127
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000691
Family FHA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028123   Gene: ENSPTRG00000016374   Transcript: ENSPTRT00000030457
Sequence length 184
Comment pep:known chromosome:CHIMP2.1.4:4:114908754:114917487:-1 gene:ENSPTRG00000016374 transcript:ENSPTRT00000030457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFEDADTEETVTCLQMTVYHPGHLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTF
QDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFG
EYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQNSSPTEMD
ENES
Download sequence
Identical sequences H2QQ19
ENSPTRP00000028123 9598.ENSPTRP00000028123 ENSPTRP00000028123 XP_526660.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]