SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028125 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028125
Domain Number 1 Region: 977-1239
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.47e-58
Family MHCK/EF2 kinase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028125   Gene: ENSPTRG00000016375   Transcript: ENSPTRT00000030459
Sequence length 1244
Comment pep:known chromosome:CHIMP2.1.4:4:115005724:115070033:1 gene:ENSPTRG00000016375 transcript:ENSPTRT00000030459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWP
FVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYG
LDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGT
WLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLG
ILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAV
NIRGTCLLSYSSSNDCPPEMKNLYLCEAKEAFEIGLLTKRDDEPVTGKQELHSFVKAAFG
LTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQ
VQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNE
QKDAKTGVCITALKTEIKNIDTVSTTQEKPHCQRDTGISSSLVGKNVQRELRRGGRRNWT
HSDAFRVSLDQDVETETEPSDYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNY
HVDDRSARKEPGKEHLVDTQCSTALSEELENDREGRAVHSLRSQLHDLSLQEPNNDNLEH
SQNQPQQQMPLTPFSPHNTPGTFLAPGAGLLEGAPEGIQEVRNMGPRNTSAHSRPSYRSA
SWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRHGKEQEEEISERGSGPTFKA
SPSWVDPEGETAESTEDAPLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVA
EHGIDPDASTVDEEGQLLDSTDVPCTNGHGSHRLCTLRQPPGQKVETPNSSVSGNILFPV
LSEDCTTTEEGNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVS
LPGKMRKEILEARTLQPDDFEKLLAGVRHDWLFQRLENTGVFKPSQLHRAHTALLLKYSK
NSELWTAQETIVYLGDYLTVKKKGRQRNAFWVHHLHQEEILGRYVGKDYKEQKGLWHHFT
DVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVK
LSNNTKVVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSV
DQRVVTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKPCT
Download sequence
Identical sequences H2QQ20
ENSPTRP00000028125 9598.ENSPTRP00000028125 XP_016807524.1.37143 XP_016807525.1.37143 ENSPTRP00000028125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]