SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028317 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028317
Domain Number 1 Region: 5-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.06e-74
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 396-577
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.000000293
Further Details:      
 
Domain Number 3 Region: 729-784
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 4 Region: 264-366
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000108
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028317   Gene: ENSPTRG00000016497   Transcript: ENSPTRT00000030663
Sequence length 785
Comment pep:known chromosome:CHIMP2.1.4:4:150737899:151075781:1 gene:ENSPTRG00000016497 transcript:ENSPTRT00000030663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKF
AHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKF
NMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSPMQAFSEEKAK
QWWKPLXGKEAXXXXFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVVG
VSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIV
PAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPT
LMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQSK
RQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKNH
LLADGGSFGDWASTVPGQTRSSMVQWLNPQSPTTTSSNPAVTPLSPGSSPFPFSPPATVA
DKPPESISSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQN
YVKLL
Download sequence
Identical sequences ENSPTRP00000028317 ENSPTRP00000028317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]