SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028524 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000028524
Domain Number - Region: 495-537
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000139
Family Double-stranded RNA-binding domain (dsRBD) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028524   Gene: ENSPTRG00000016629   Transcript: ENSPTRT00000030884
Sequence length 580
Comment pep:known chromosome:CHIMP2.1.4:4:186770234:186773783:1 gene:ENSPTRG00000016629 transcript:ENSPTRT00000030884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEA
ADAESGTRNRQLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDE
LVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIG
SAIKSESGNSARSSGISSQNSSTSDGDRSVSSQSSSSVSSQVTTAGSGKASEAEAPDKHG
SASFVSLLKSSVNSHMTQSTDSRQQSGSPKKSALEGSSASASQSSSEIEVPLLGSSGSSE
VELPLLSSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSSSSTNTSLLTS
KSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLASKSSSQTSTSQLPSKSTSQSSES
SVKFSCKLTNEDVKQKQPFFNRLYKTVAWKLVAVGGFSPNVNHGELLNAAIEALKATLDV
FFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKV
VVKICKRKYRGSEIEDLVLLDEESRPVNLPPALKHPQELL
Download sequence
Identical sequences H2QQH5 Q9NXV6
ENSP00000427108 9598.ENSPTRP00000028524 9606.ENSP00000303788 ENSPTRP00000028524 NP_060102.1.87134 NP_060102.1.92137 XP_003823499.1.60992 XP_517548.2.37143 ENSP00000427108 gi|8923040|ref|NP_060102.1| ENSPTRP00000028524 ENSP00000303788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]