SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028691 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028691
Domain Number 1 Region: 41-490
Classification Level Classification E-value
Superfamily Sema domain 9.03e-139
Family Sema domain 0.000000143
Further Details:      
 
Domain Number 2 Region: 837-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.06e-17
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 783-834
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000235
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 4 Region: 595-645
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000484
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 486-538
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000148
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 650-701
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000772
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 7 Region: 896-941
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000693
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 539-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000114
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028691   Gene: ENSPTRG00000016722   Transcript: ENSPTRT00000031062
Sequence length 1074
Comment pep:known chromosome:CHIMP2.1.4:5:9126679:9464793:-1 gene:ENSPTRG00000016722 transcript:ENSPTRT00000031062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRAEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY
AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
DLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPNPNPHFQCGTV
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII
YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVV
KIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVD
GHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
PWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS
EWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
Download sequence
Identical sequences H2QQM4
XP_008959676.1.60992 XP_008959677.1.60992 XP_014200311.1.60992 XP_016808428.1.37143 ENSPTRP00000028691 9598.ENSPTRP00000028691 ENSPTRP00000028691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]