SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028692 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028692
Domain Number 1 Region: 5-298
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000022
Family Rhodopsin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028692   Gene: ENSPTRG00000016723   Transcript: ENSPTRT00000031063
Sequence length 299
Comment pep:known chromosome:CHIMP2.1.4:5:9716429:9717328:-1 gene:ENSPTRG00000016723 transcript:ENSPTRT00000031063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRKMAPLDLLLSCLAVSRIFLQL
FIFYVNVIVIFFIEFIMCSANCAILLFVNELELWLATWLGVFYCAKVASVRHPLFIWLKM
RISKLVPWMILGSLLYVSMICVFHSKYAGFMVPHFLRNFFSQNATIQKEDTLAIQIFSFV
AEFSVPLLIFLVAVLLLIFSLGRHTRQMRNTVAGSRVPGRGAPISALLSILSFLILYFSH
CMIKVFLSSLKFHVRRFIFLFFILVIGMYPSGHSLILILGNPKLKQNAKKFLLHSKCCQ
Download sequence
Identical sequences J7M7J6
9598.ENSPTRP00000028692 ENSPTRP00000028692 ENSPTRP00000028692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]