SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028768 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028768
Domain Number 1 Region: 243-454
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.54e-56
Family Reprolysin-like 0.00046
Further Details:      
 
Domain Number 2 Region: 541-596
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000249
Family TSP-1 type 1 repeat 0.00019
Further Details:      
 
Domain Number 3 Region: 1450-1509
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000127
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 924-976
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000536
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 804-862
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000615
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 1397-1450
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 1338-1402
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.0087
Further Details:      
 
Domain Number 8 Region: 1293-1343
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000497
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 9 Region: 861-920
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000122
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028768   Gene: ENSPTRG00000016776   Transcript: ENSPTRT00000031146
Sequence length 1572
Comment pep:known chromosome:CHIMP2.1.4:5:81288904:81664019:1 gene:ENSPTRG00000016776 transcript:ENSPTRT00000031146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRV
DASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIME
KRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVK
KHPLVEGGYHPHIVYRRQKVPETKEPTCGLKDSVNISRKQELWREKWERHNLPSRSLSRR
SISKERWVETLVVADTKMIEYHGSENVESYILTIMNMVTGLFHNPSIGNAIHIVVVRLIL
LEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLLTRKDICAGFNRPCET
LGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPVGRHPYIMS
RQLQYDPTPLTWSKCSEEYITRFLDRGWGFCLDDIPKKKGLKSKVIAPGVIYDVHHQCQL
QYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPES
IPGGWGRWSPWSHCSRTCGAGVQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCRSET
PTFRQMQCSEFDTVPYKNELYHWFPIFNPAHPCELYCRPIDGQFSEKMLDAVTDGTPCFE
GGNSRNVCINGICKMVGCDYEIDSSATEDRCGVCLYVDIGLIPKGARDIRVMEIEGAGNF
LAIRSEDPEKYYLNGGFIIQWNGNYKLAGTVFQYDRKGDLEKLMATGPTNESVWIQLLFQ
VTNPGIKYEYTIQKDGLDNDVEQQMYFWQYGHWTECSVTCGTGIRRQTAHCIKKGRGMVK
ATFCDPETQPNGRQKKCHEKACPPRWWAGEWEACSATCGPHGEKKRTVLCIQTMGSDEQA
LPPTDCQHLLKPKTLLSCNRDILCPSDWTVGNWSECSVSCGGGVRIRSVTCAKNHDEPCD
VTRKPNSRALCGLQQCPSSRRVLKPNKGTISNGKNPPTLKPVPPPTSRPRMLTTPTGPES
MSTSTPAISSPSPTTASKEGDLGGKWQDSSTSEKSSRYLISTGSTSQPILTSQSLSIQPS
EENVSSSDTGPTSEGGLVATTTSGSGLSSSHNPITWPVTPFYNTLTKGPETEIHSGSGEE
REQPEDKDESNPVIWTKIRVPGNDAPVESTEMPLAPPLTPDLSRESWWPPFSTVMEGLLP
SQRPTTSETGTPRVEGMVTEKPANTLLPLGGDHQPEPSGKTANHNHLKLPNNMNQTKSSE
PVLTEEDATSLIAEGFLLNASNYKQLTNGHGSAHWIVGNWSECSTTCGLGAYWRRVECST
QMDSDCAAIQRPDPAKRCHLRPCAGWKVGNWSKCSRNCSGGFKIREIQCVDSRDHRNLRP
FHCQFLAGIPPPLSMSCNPEPCEAWQVEPWSQCSRSCGGGVQERGVFCPGGLCDWTKRPT
STLSCNEHLCCHWATGNWDLCSTSCGGGFQKRTVQCVPSEGNKTEDQDQCLCDHKPRPPE
FKKCNQQACKKSADLLCTKDKLSASFCQTLKAMKKCSVPTVRAECCFSCPQTHITHTQRQ
RRRRLLQKPKEL
Download sequence
Identical sequences ENSPTRP00000028768 ENSPTRP00000028768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]