SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028833 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028833
Domain Number 1 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 41-89
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000549
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 3 Region: 71-119,505-540
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000135
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028833   Gene: ENSPTRG00000016816   Transcript: ENSPTRT00000031216
Sequence length 559
Comment pep:known chromosome:CHIMP2.1.4:5:75772263:75852209:1 gene:ENSPTRG00000016816 transcript:ENSPTRT00000031216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCNPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLVYETKGEKNLRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGIYELIY
VLDKASMNRKGVELKDIKRCLGYHLDVSLDFSEISVGAEFNKDDCVKRGEGRAVNITSEN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVKWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK
Download sequence
Identical sequences 9598.ENSPTRP00000028833 ENSPTRP00000028833 ENSPTRP00000028833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]