SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029006 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029006
Domain Number 1 Region: 379-696
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-85
Family Protein kinases, catalytic subunit 0.00000151
Further Details:      
 
Domain Number 2 Region: 192-292
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 1.83e-43
Family MAST3 pre-PK domain-like 0.0000132
Further Details:      
 
Domain Number 3 Region: 950-1042
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-19
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029006   Gene: ENSPTRG00000016938   Transcript: ENSPTRT00000031406
Sequence length 2433
Comment pep:known chromosome:CHIMP2.1.4:5:48107246:48455401:-1 gene:ENSPTRG00000016938 transcript:ENSPTRT00000031406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESSILRRRGLQKELSLPRRGSFLFKLCFFFLFDSCRTSNRKSLIGNGQSPALPRPHSP
LSAHAGLCPRACPGXFSPGASARFSFARRTDGRRWSLASLPSSGYGTNTPSSTVSSSCSS
QEKLHQLPYQPTPDELHFLSKHFCTTESIATENRCRNTPMRPRSRSLSPGRSPACCDHEI
IMMNHVYKERFPKATAQMEERLKEIITSYSPDNVLPLADGVLSFTHHQIIELARDCLDKS
HQGLITSRYFLELQHKLDKLLQEAHNRSESGELAFIKQLVRKILIVIARPARLLECLEFD
PEEFYYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPLEEMAQLGNYDSGTAETPETD
ESVSSSNASLKLRRKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKKINKQNLILR
NQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLMKNMGPLPVDM
ARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEG
HIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPE
ELFGQVISDEINWPEKDEAPPPDAQDLITLLLRQNPLERLGTGGAYEVKQHRFFRSLDWN
SLLRQKAEFIPQLESEDDTSYFDTRSEKYHHMETEEEDDTNDEDFNVEIRQFSSCSHRFS
KVFSSIDRITQNSAEEKEDSGDKTKSTTLPSTETLSWSSEYSEMQQLSTSNSSDTESNRH
KLSSGLLPKLAISTEGEQDEAASCPGDPHEEPGKPVLPPEECAQEEPEVTTPASTISSST
LSVGSFSEHLDQINGRSECVDSTDNSSKPSSEPASHMARQRLESTEKKKISGKVTKSLSA
SALSLMIPGDMFAVSPLGSPMSPHSLSSDPSSSRDSSPSRDSSAASASPHQPIVIHSSGK
NYGFTIRAIRVYVGDSDIYTVHHIVWNVEEGSPACQAGLKAGDLITHINGEPVHGLVHTE
VIELLLKSGNKVSITTTPFENTSIKTGPARRNSYKSRMVRRSKKSKKKESLERRRSLFKK
LAKQPSPLLHTSRSFSCLNRSLSSGESLPGSPTHSLSPRSPTPSYRSTPDFPSGTNSSQS
SSPSSSAPNSPAGSGHIRPSTLHGLAPKLGGQRYRSGRRKSAGNIPLSPLARTPSPTPQP
TSPQRSPSPLLGHSLGNSKIAQAFPSKMHSPPTIVRHIVRPKSAEPPRSPLLKRVQSEEK
LSPSYGSDKKHLCSRKHSLEVTQEEVQREQSQREAPLQSLDENVCDVPPLSRARPVEQGC
LKRPVSRKVGRQESVDDLDRDKLKAKVVVKKPDGFPEKQESHQKSHGPGSDLENFALFKL
EEREKKIYPKAVERSSPFENKASVQEAPPLGSLLKDALHKQASVRASEGAMSDGPVPAEH
GQGGGDFRRAPAPGTLQDGLCHSLDRGISGKGEGTEKSSQAKELLRCEKLDSKLANIDYL
RKKMSLEDKEDNLCPVLKPKMTAGSHECLPGNPVRPTGGQQEPPPASESRAFVSSTHAAQ
MSAVSFVPLKALTGRVDSGTEKPGLVAPESPVRKSPSEYKLEGRSVSCLKPIEGTLDIAL
LSGPQASKTELPSPESAQSPSPSGDVRASVPPALPSSSGKKNDTTSARELSPSSLKMNKS
YLLEPRFLPPSRGLQNSPAVSLPDPELKRDRKGPHPTARSPGTVMESNPQQRESSSPKHQ
DHTTDPKLLTCLGQNLHSPDLARPRCPLPPEASPSREKPGLRESSERGPPTARSERSAAR
ADTCREPSMELCFPETAKTSDNSKNLLSVGRTHPDFYTQTQAMEKAWAPGGKTNHKDGPD
EARPPPRDNSSLHSAGIPCEKELGKVRRGVEPKPEALLARRSLQPLGIESEKSEKLSSFP
ALQKDGAKEPERKEQPLQRHPSSIPPPPLTAKDLSSPAARQHCSSPSHASGREPGAKPST
AEPSPSPQDPPKPVAAHSESSSHKPRPGPDPGPPKTKHPDRSLSSQKPSVGATKGKEPAT
QSLGGSSREGKGHSKSGPDVFPATPGSQNKASDGIGQGEGGPSVPLHTDRGPLDAKPQPT
SGGRPLEVLEKPVHLPRPGHPGPSEPADQKLSTVGEKQTLSPKHPKPSTVKDCPTLCKQT
DNRQTDKSPSQPAANTDRRAEGKKCTEALYAPAEGDKLEAGLSFAHSENRLKGAERPAAG
VGKGFPEARGKGPGPQKPPTEADKPNGMKRSPSATGQSSFRSTALPEKSLSCSSSFPETR
AGVREASAASSDTSSAKAGGMLELPAPSNRDHRKAQPAGEGRTHMTKSDSLPSFRVSTLP
LESHHPDPNTMGGASHRDRALSVTATVGETKGKDPAPAQPPPARKQNVGRDVTKPSPAPN
TDRPISLSNEKDFVVRQRRGKESLRSSPHKKAL
Download sequence
Identical sequences ENSPTRP00000029006 ENSPTRP00000029006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]