SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029020 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029020
Domain Number 1 Region: 8-299
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.46e-98
Family Protein kinases, catalytic subunit 0.0000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029020   Gene: ENSPTRG00000016946   Transcript: ENSPTRT00000031421
Sequence length 346
Comment pep:known chromosome:CHIMP2.1.4:5:45952366:45996035:-1 gene:ENSPTRG00000016946 transcript:ENSPTRT00000031421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Download sequence
Identical sequences A0A0S2Z3F9 A0A2I3S9X0 G3RC03 P50613
1ua2_A 1ua2_B 1ua2_C 1ua2_D ENSPTRP00000029020 9598.ENSPTRP00000029020 9606.ENSP00000256443 ENSP00000256443 ENSP00000479116 Hs4502743___KOG0659 gi|4502743|ref|NP_001790.1| ENSP00000421559 ENSP00000460075 ENSPTRP00000029020 1ua2A NP_001790.1.87134 NP_001790.1.92137 XP_001160482.1.37143 XP_003806836.1.60992 XP_004058792.1.27298 IGBMC-0027-000 ENSP00000256443 ENSP00000460075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]