SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029277 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029277
Domain Number 1 Region: 97-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.11e-29
Family RIO1-like kinases 0.00019
Further Details:      
 
Domain Number 2 Region: 8-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-22
Family Rio2 serine protein kinase N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029277   Gene: ENSPTRG00000017100   Transcript: ENSPTRT00000031690
Sequence length 552
Comment pep:known chromosome:CHIMP2.1.4:5:97419441:97443421:-1 gene:ENSPTRG00000017100 transcript:ENSPTRT00000031690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKVNVAKLRYMSRDDFRVLIAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHK
LIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGNQMGVGKESDIYIVANEEGQQF
ALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPID
YNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGDFNEFNLILDESD
HITMIDFPQMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEV
SASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYRSENESEQNCLE
ESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFDQALEEIKGQVVENNSVTEFSEEK
NRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEDNVGAMNQYRTR
TLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNI
KSSLEAASFWGE
Download sequence
Identical sequences K7DCC8
ENSPTRP00000029277 ENSPTRP00000029277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]